Year of publication
Type of media
Source
Subject
Type of material
TIB reading rooms collection
LUH institutes collection
1–20 of 586 hits
Sort by:
Sort by:
-
C1q, a small molecule with high impact on brain development: putative role for aging processes and the occurrence of Alzheimer’s disease
Free accessOnline Contents | 2021| -
Neuroinflammation and psychiatric disorders: Relevance of C1q, translocator protein (18 kDa) (TSPO), and neurosteroids
Taylor & Francis Verlag | 2022| -
Ganzheitliche Verfahrens- und Schichtoptimierung für das Hochgeschwindigkeitsdrahtflammspritzen
Free accessBASE | 2008| -
What does CLIP know about a red circle? Visual prompt engineering for VLMs
Free accessArXiv | 2023| -
PoseDiffusion: Solving Pose Estimation via Diffusion-aided Bundle Adjustment
Free accessArXiv | 2023| -
Viewset Diffusion: (0-)Image-Conditioned 3D Generative Models from 2D Data
Free accessArXiv | 2023|
Send my search to (beta)
Send your search query (search terms without filters) to other databases, portals and catalogues to find more interesting hits.
Dimensions:
full data search
or
title and abstract search
Dimensions is a database for abstracts and citations that links information on research funding with the resulting publications, studies and patents.
TIB AV portal
In the TIB AV-Portal, audiovisual media from science and teaching can be foundand own scientific videos can be published.
Specialised Information Service for Mobility and Transport Research (FID move)
Open Research Knowledge Graph (ORKG)
The FID move can be used to search for subject-specific literature, research data and other information from mobility and transport research.
The Open Research Knowledge Graph provides structured descriptions of research content and makes it comparable.
Common Union Catalogue (GVK)
Freely accessible part of the collaborative K10plus catalogue with materials relevant for interlibrary loan and direct delivery services.